SLC7A3 / CAT3 antibody
| Name | SLC7A3 / CAT3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333604 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-Slc7a3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC7A3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Slc7a3 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Spleen