SLC16A6 / MCT7 antibody
| Name | SLC16A6 / MCT7 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333963 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-SLC16A6 Antibody: synthetic peptide directed towards the middle region of human SLC16A6. Synthetic peptide located within the following region: ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC16A6 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC16A6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate