SLC17A4 antibody

Name SLC17A4 antibody
Supplier Acris Antibodies
Catalog TA333941
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC-P WB
Species Reactivities Bovine, Horse, Guinea Pig, Human, Mouse, Rat
Antigen The immunogen for Anti-SLC17A4 Antibody: synthetic peptide directed towards the middle region of human SLC17A4. Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SLC17A4
Supplier Page Shop

Product images