Name | SLC17A4 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA333941 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P WB |
Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Rat |
Antigen | The immunogen for Anti-SLC17A4 Antibody: synthetic peptide directed towards the middle region of human SLC17A4. Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | SLC17A4 |
Supplier Page | Shop |