SLC22A14 / ORCTL4 antibody
| Name | SLC22A14 / ORCTL4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333959 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-SLC22A14 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC22A14. Synthetic peptide located within the following region: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A14 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SLC22A14; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0 ug/ml