SLC22A25 antibody

Name SLC22A25 antibody
Supplier Acris Antibodies
Catalog TA334881
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-SLC22A25 antibody is: synthetic peptide directed towards the middle region of Human SLC22A25. Synthetic peptide located within the following region: VFFLFSRWLAESARWLIINNKPEEGLKELRKAAHRNGMKNAEDILTMEVL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SLC22A25
Supplier Page Shop

Product images