Name | SLC25A35 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA334634 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat |
Antigen | The immunogen for anti-SLC25A35 antibody: synthetic peptide directed towards the N terminal of human SLC25A35. Synthetic peptide located within the following region: DFLMSGLAACGACVFTNPLEVVKTRMQLQGELQAPGTYQRHYRNVFHAFI. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | SLC25A35 |
Supplier Page | Shop |