Name | SLC25A45 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA334123 |
Prices | $325.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | IHC-P WB |
Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
Antigen | The immunogen for Anti-SLC25A45 Antibody: synthetic peptide directed towards the C terminal of human LOC283130. Synthetic peptide located within the following region: GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | SLC25A45 |
Supplier Page | Shop |