SLC25A45 antibody
| Name | SLC25A45 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334123 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-SLC25A45 Antibody: synthetic peptide directed towards the C terminal of human LOC283130. Synthetic peptide located within the following region: GLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEY. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC25A45 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC25A45 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysate