Name | SLC35B1 / UGTREL1 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA333931 |
Prices | $325.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
Antigen | The immunogen for Anti-SLC35B1 Antibody: synthetic peptide directed towards the C terminal of human SLC35B1. Synthetic peptide located within the following region: ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | SLC35B1 |
Supplier Page | Shop |