SLC35B1 / UGTREL1 antibody
| Name | SLC35B1 / UGTREL1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333931 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-SLC35B1 Antibody: synthetic peptide directed towards the C terminal of human SLC35B1. Synthetic peptide located within the following region: ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC35B1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC35B1 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate