Name | SLC35C1 / FUCT1 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA333752 |
Prices | $325.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | The immunogen for Anti-SLC35C1 Antibody: synthetic peptide directed towards the N terminal of human SLC35C1. Synthetic peptide located within the following region: TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | SLC35C1 |
Supplier Page | Shop |