SLC35E2 antibody
| Name | SLC35E2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334629 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Rabbit |
| Antigen | The immunogen for anti-SLC35E2 antibody: synthetic peptide directed towards the middle region of human SLC35E2. Synthetic peptide located within the following region: AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC35E2B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC35E2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: COLO205 cell lysate