SLC35F2 antibody
| Name | SLC35F2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333772 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-SLC35F2 Antibody: synthetic peptide directed towards the N terminal of human SLC35F2. Synthetic peptide located within the following region: MEADSPAGPGAPEPLAEGAAAEFSSLLRRIKGKLFTWNILKTIALGQMLS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC35F2 |
| Supplier Page | Shop |
Product images
WB Suggested Antibody Titration: 2.5 ug/ml; Positive Control: 293T