Name | SLC35G3 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA334400 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | The immunogen for anti-SLC35G3 antibody is: synthetic peptide directed towards the N-terminal region of Human SLC35G3. Synthetic peptide located within the following region: PPSLRWYQRCQPSDATSGLLVALLGGGLPAGFVGPLSRMAYQASNLPSLE. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | SLC35G3 |
Supplier Page | Shop |