SLC36A3 / PAT3 antibody
| Name | SLC36A3 / PAT3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334623 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human, Pig |
| Antigen | The immunogen for anti-SLC36A3 antibody: synthetic peptide directed towards the N terminal of human SLC36A3. Synthetic peptide located within the following region: MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC36A3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC36A3 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate