SLC41A3 antibody
| Name | SLC41A3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334149 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-SLC41A3 Antibody: synthetic peptide directed towards the C terminal of human SLC41A3. Synthetic peptide located within the following region: WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC41A3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC41A3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Hela cell lysate;SLC41A3 is supported by BioGPS gene expression data to be expressed in HeLa