SLC43A3 antibody
| Name | SLC43A3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333769 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-SLC43A3 Antibody: synthetic peptide directed towards the N terminal of human SLC43A3. Synthetic peptide located within the following region: MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC43A3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC43A3 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate;SLC43A3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells