SLC46A3 antibody
| Name | SLC46A3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334625 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Dog, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for anti-SLC46A3 antibody: synthetic peptide directed towards the N terminal of human SLC46A3. Synthetic peptide located within the following region: MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC46A3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SLC46A3 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate;SLC46A3 is supported by BioGPS gene expression data to be expressed in Jurkat