SLC48A1 antibody
| Name | SLC48A1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344145 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-FLJ20489 antibody: synthetic peptide directed towards the C terminal of human FLJ20489. Synthetic peptide located within the following region: LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SLC48A1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FLJ20489 Antibody Titration: 0.0625 ug/ml; Positive Control: HepG2 cell lysate