SLCO1B7 antibody

Name SLCO1B7 antibody
Supplier Acris Antibodies
Catalog TA336136
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-LST-3TM12 Antibody: synthetic peptide directed towards the middle region of human LST-3TM12. Synthetic peptide located within the following region: RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SLCO1B7
Supplier Page Shop

Product images