SMCO4 antibody
| Name | SMCO4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330701 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast |
| Antigen | The immunogen for Anti-C11orf75 antibody is: synthetic peptide directed towards the N-terminal region of Human C11orf75. Synthetic peptide located within the following region: KPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPT. |
| Description | Rabbit Polyclonal |
| Gene | SMCO4 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C11orf75; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml