SNAP47 antibody
| Name | SNAP47 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344347 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SNAP47 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-C1orf142 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: PANC1 cell lysate