SORBS1 / Ponsin antibody
| Name | SORBS1 / Ponsin antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339964 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-Sorbs1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sorbs1. Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Sorbs1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Sorbs1 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Testis