SPATA12 / SRG5 antibody
| Name | SPATA12 / SRG5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339827 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-SPATA12 antibody: synthetic peptide directed towards the N terminal of human SPATA12. Synthetic peptide located within the following region: MSSSALTCGSTLEKSGDTWEMKALDSSRLVPWPPRGLGSSTQHPNKPHCA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SPATA12 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SPATA12 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate