SPATA33 antibody

Name SPATA33 antibody
Supplier Acris Antibodies
Catalog TA333471
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-C16orf55 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf55. Synthetic peptide located within the following region: EEQKKGSTYSVPKSKEKLMEKHSQEARQADRESEKPVDSLHPGAGTAKHP.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene SPATA33
Supplier Page Shop

Product images