Spindlin 2A / SPIN2A antibody
| Name | Spindlin 2A / SPIN2A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331359 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-SPIN2A antibody is: synthetic peptide directed towards the N-terminal region of Human SPIN2A. Synthetic peptide located within the following region: MTKKKVSQKKQRGRPSSQPCRNIVGCRISHGWKEGDEPITQWKGTVLDQV. |
| Description | Rabbit Polyclonal |
| Gene | SPIN2A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SPIN2A Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell