ST6GALNAC3 antibody
| Name | ST6GALNAC3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330985 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish |
| Antigen | The immunogen for anti-ST6GALNAC3 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC3. Synthetic peptide located within the following region: HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ST6GALNAC3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-ST6GALNAC3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate