Name | ST6GALNAC3 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA330985 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Dog, Horse, Human, Mouse, Pig, Rat, Zebrafish |
Antigen | The immunogen for anti-ST6GALNAC3 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC3. Synthetic peptide located within the following region: HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | ST6GALNAC3 |
Supplier Page | Shop |