SUSD3 antibody
| Name | SUSD3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333507 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Human, Pig |
| Antigen | The immunogen for Anti-SUSD3 Antibody: synthetic peptide directed towards the N terminal of human SUSD3. Synthetic peptide located within the following region: LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SUSD3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-SUSD3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Placenta