SYDE2 antibody
| Name | SYDE2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333621 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Rabbit, Rat |
| Antigen | The immunogen for Anti-SYDE2 Antibody is: synthetic peptide directed towards the N-terminal region of Human SYDE2. Synthetic peptide located within the following region: ENRVLSVPPDQRITLTDLFENAYGSSMKGRELEELKDNIEFRGHKPLNSI. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | SYDE2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: SYDE2; Sample Tissue: OVCAR-3 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.