TAF7L antibody
| Name | TAF7L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329954 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for Anti-Taf7l antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Taf7l. Synthetic peptide located within the following region: QMIYKKAQRQKELLRKVENLTLKRHFQNVLGKLNIMEKEKCEQIYHLQEQ. |
| Description | Rabbit Polyclonal |
| Gene | Taf7l |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: Taf7l; Sample Tissue: Mouse Muscle lysates; Antibody Dilution: 1.0 ug/ml