TATDN3 antibody
| Name | TATDN3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332229 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-TATDN3 Antibody is: synthetic peptide directed towards the C-terminal region of Human TATDN3. Synthetic peptide located within the following region: FSIPPSIIRSGQLLSLFSKKQKLVKQLPLTSICLETDSPALGPEKQQNIL. |
| Description | Rabbit Polyclonal |
| Gene | TATDN3 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TATDN3; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml