TBC1D3G antibody
| Name | TBC1D3G antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332235 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-TBC1D3G Antibody is: synthetic peptide directed towards the middle region of Human TBC1D3G. Synthetic peptide located within the following region: HVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLGLTLRLWDVYL. |
| Description | Rabbit Polyclonal |
| Gene | LOC101060321 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TBC1D3G; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml