TBC1D8B antibody
| Name | TBC1D8B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331514 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-TBC1D8B Antibody is: synthetic peptide directed towards the N-terminal region of Human TBC1D8B. Synthetic peptide located within the following region: FDSNEDITNFVQGKIRGLIAEEGKHCFAKEDDPEKFREALLKFEKCFGLP. |
| Description | Rabbit Polyclonal |
| Gene | TBC1D8B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TBC1D8B; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0ug/ml