TBC1D25 / OATL1 antibody

Name TBC1D25 / OATL1 antibody
Supplier Acris Antibodies
Catalog TA337671
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for anti-TBC1D25 antibody: synthetic peptide directed towards the N terminal of human TBC1D25. Synthetic peptide located within the following region: KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGG.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene TBC1D25
Supplier Page Shop

Product images