TCEAL8 antibody

Name TCEAL8 antibody
Supplier Acris Antibodies
Catalog TA342115
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-TCEAL8 antibody: synthetic peptide directed towards the middle region of human TCEAL8. Synthetic peptide located within the following region: PQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELER.
Description Rabbit Polyclonal
Gene TCEAL8
Supplier Page Shop

Product images