TCF23 antibody
| Name | TCF23 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329967 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-TCF23 antibody: synthetic peptide directed towards the C terminal of mouse TCF23. Synthetic peptide located within the following region: PMRSRLYAGGLGCSDLDSTTAITTGQRCKDAELGSQDSVAAESLLTSPAF. |
| Description | Rabbit Polyclonal |
| Gene | Tcf23 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TCF23 Antibody Titration: 2.5ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate