TDRD12 antibody
| Name | TDRD12 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332195 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Human, Pig |
| Antigen | The immunogen for Anti-TDRD12 Antibody is: synthetic peptide directed towards the C-terminal region of Human TDRD12. Synthetic peptide located within the following region: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY. |
| Description | Rabbit Polyclonal |
| Gene | TDRD12 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TDRD12; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/mlTDRD12 is supported by BioGPS gene expression data to be expressed in 721_B