TDRP antibody
| Name | TDRP antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334797 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Mouse, Rat |
| Antigen | The immunogen for anti-C8orf42 antibody is: synthetic peptide directed towards the N-terminal region of Human C8orf42. Synthetic peptide located within the following region: EQHLLERCKSPKSKGTNLRLKEELKAEKKSGFWDNLVLKQNIQSKKPDEI. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TDRP |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C8orf42; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0 ug/ml