TESSP5 antibody
| Name | TESSP5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331511 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-PRSS45 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS45. Synthetic peptide located within the following region: WILAGVLSWEKACVKAQNPGVYTRITKYTKWIKKQMSNGAFSGPCASACL. |
| Description | Rabbit Polyclonal |
| Gene | PRSS45 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: PRSS45; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml