Tetraspanin-11 / TSPAN11 antibody
| Name | Tetraspanin-11 / TSPAN11 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330800 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig |
| Antigen | The immunogen for Anti-TSPAN11 antibody is: synthetic peptide directed towards the middle region of Human TSPAN11. Synthetic peptide located within the following region: HLNRTLAENYGQPGATQITASVDRLQQDFKCCGSNSSADWQHSTYILLRE. |
| Description | Rabbit Polyclonal |
| Gene | TSPAN11 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TSPAN11; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml