TIGD4 antibody
| Name | TIGD4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338805 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rat |
| Antigen | The immunogen for anti-TIGD4 antibody: synthetic peptide directed towards the N terminal of human TIGD4. Synthetic peptide located within the following region: RFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQK. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TIGD4 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TIGD4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate