TIPARP antibody

Name TIPARP antibody
Supplier Acris Antibodies
Catalog TA334264
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-TIPARP antibody: synthetic peptide directed towards the N terminal of human TIPARP. Synthetic peptide located within the following region: LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene TIPARP
Supplier Page Shop

Product images