TLCD1 antibody
| Name | TLCD1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332169 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human, Rabbit |
| Antigen | The immunogen for Anti-TLCD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human TLCD1. Synthetic peptide located within the following region: RYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFL. |
| Description | Rabbit Polyclonal |
| Gene | TLCD1 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: TLCD1; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0ug/ml