TM2D2 / BLP1 antibody
| Name | TM2D2 / BLP1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342997 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Goat, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-TM2D2 antibody: synthetic peptide directed towards the middle region of human TM2D2. Synthetic peptide located within the following region: QELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYT. |
| Description | Rabbit Polyclonal |
| Gene | TM2D2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TM2D2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate