TM4SF20 antibody
| Name | TM4SF20 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338678 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Human, Rabbit, Rat |
| Antigen | The immunogen for anti-TM4SF20 antibody: synthetic peptide directed towards the middle region of human TM4SF20. Synthetic peptide located within the following region: QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TM4SF20 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TM4SF20 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HT1080 cell lysate