TMCO1 / TMCC4 antibody
| Name | TMCO1 / TMCC4 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331078 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-TMCO1 antibody: synthetic peptide directed towards the C terminal of human TMCO1. Synthetic peptide located within the following region: CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TMCO1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMCO1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Liver