TMCO3 antibody
| Name | TMCO3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342047 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-TMCO3 antibody: synthetic peptide directed towards the N terminal of human TMCO3. Synthetic peptide located within the following region: KTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRAL. |
| Description | Rabbit Polyclonal |
| Gene | TMCO3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMCO3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Hela cell lysate