TMEM9 antibody

Name TMEM9 antibody
Supplier Acris Antibodies
Catalog TA342012
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for anti-TMEM9 antibody: synthetic peptide directed towards the C terminal of human TMEM9. Synthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS.
Description Rabbit Polyclonal
Gene TMEM9
Supplier Page Shop

Product images