TMEM48 / NDC1 antibody
| Name | TMEM48 / NDC1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339341 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-TMEM48 antibody: synthetic peptide directed towards the middle region of human TMEM48. Synthetic peptide located within the following region: SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NDC1 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMEM48 Antibody Titration: 0.2-1 ug/ml; Positive Control: THP-1 cell lysate