TMEM63A antibody
| Name | TMEM63A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343815 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast |
| Antigen | The immunogen for anti-TMEM63A antibody: synthetic peptide directed towards the N terminal of human TMEM63A. Synthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM63A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMEM63A Antibody Titration: 0.2-1 ug/ml; Positive Control: 293T cell lysate