TMEM69 antibody
| Name | TMEM69 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA342015 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-TMEM69 antibody: synthetic peptide directed towards the middle region of human TMEM69. Synthetic peptide located within the following region: AYGASFLSFLGGIRWGFALPEGSPAKPDYLNLASSAAPLFFSWFAFLISE. |
| Description | Rabbit Polyclonal |
| Gene | TMEM69 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMEM69 Antibody Titration: 0.5 ug/ml; Positive Control: HepG2 cell lysate