TMEM91 antibody
| Name | TMEM91 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335951 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Horse, Human, Pig |
| Antigen | The immunogen for Anti-TMEM91 Antibody: synthetic peptide directed towards the N terminal of human TMEM91. Synthetic peptide located within the following region: SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM91 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-TMEM91 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate